PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_76757.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NF-YA
Protein Properties Length: 342aa    MW: 37193.7 Da    PI: 8.7367
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_76757.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA96.82.4e-30176233158
     CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                   d+p+YVNaKQy++Il+RR +Rak+e+e++l ++ ++pylheSRh hA+rR+RgsgGrF
  MLOC_76757.2 176 DAPVYVNAKQYEGILRRRRARAKAEKENRLVKARKQPYLHESRHLHAMRRARGSGGRF 233
                   68****************************9999***********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005215.7E-34174236IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.096175236IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.0E-22178200IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.3E-26178233IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860180200IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.0E-22210233IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009567Biological Processdouble fertilization forming a zygote and endosperm
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MMSFKNHHEG FTGQHLVAAA AASQASGGAP LPWWVGSQLL YGEPMGHGKA PPAVPVSMSP  60
PQDACRDGQF QVVPRGGQPL LDAVPLPPQP MPERGIPEAL KFSMAHGKGG NSSEHSAPIT  120
LQSPFTEYND HFELGLGQSV ISSSYYSDQQ YGLLSSYAMR SAYSGRMLIP LNMPADAPVY  180
VNAKQYEGIL RRRRARAKAE KENRLVKARK QPYLHESRHL HAMRRARGSG GRFLNTKKET  240
NGKDTGVGST AMGGNQFMRP TASLSSEIQH SEQGNPSSVS SLSGSEVTSL YDHEDVDHYH  300
NFEHLRTHFF TPLPSIMDGE HGAGNPFKWA AASDGCCNLL KA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_A1e-16176235261HAPB protein
4g91_A1e-16176235261HAPB protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3770240.0AK377024.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3145N16.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014757443.11e-145PREDICTED: nuclear transcription factor Y subunit A-2-like isoform X1
RefseqXP_010237001.11e-145PREDICTED: nuclear transcription factor Y subunit A-2-like isoform X1
RefseqXP_003577268.11e-145PREDICTED: nuclear transcription factor Y subunit A-2-like isoform X1
TrEMBLM0Z4C20.0M0Z4C2_HORVD; Uncharacterized protein
STRINGMLOC_76757.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23073790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05690.11e-25nuclear factor Y, subunit A2